PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_12486
Common NameKK1_012866
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 326aa    MW: 37877.1 Da    PI: 5.8537
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_12486genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.11.3e-26199248352
         RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    ++isl+dl kyF +pi +A+++L+v+lTvLKr+CR++GI+RWPhRkiksl
  C.cajan_12486 199 AKISLSDLVKYFGMPIVEASRNLNVGLTVLKRKCREFGIPRWPHRKIKSL 248
                    589*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.475183268IPR003035RWP-RK domain
PfamPF020421.1E-21201248IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MDTSLLTHLL LLNNTLQPEL MRSVHVYRQG EGEEREVERE FVFSESGSYG EMQATPIFRL  60
KKSCVSEVCE GYRNGVWLCI FAFHVDHTPQ FSGIPPLLLV TRNPKLQMIP NLLNDLHKIY  120
KLDQKEEDKD IPQDSTGEEW QGNNNISEPS QKVFRVLEQD LNCLPYEEEE SELLDNDTDV  180
ESSPGLIEKK KRAPSDLVAK ISLSDLVKYF GMPIVEASRN LNVGLTVLKR KCREFGIPRW  240
PHRKIKSLDS LIHDLQEEAK HQELEDMEAA MAVTKRQKML ENEKEDIEKR PFMDIQSETK  300
RFRQDVFKRR HRARAIEKHN STVSTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0903770.0BT090377.1 Soybean clone JCVI-FLGm-4G14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517135.20.0PREDICTED: uncharacterized protein LOC100795946
TrEMBLA0A151THQ30.0A0A151THQ3_CAJCA; Uncharacterized protein
STRINGGLYMA01G36360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-82RWP-RK domain-containing protein